PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00002.1.p
Common NameEUGRSUZ_F000021, LOC104447747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 340aa    MW: 36331.7 Da    PI: 8.9298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181863147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEde l ++v+ +G+++W++I++ ++ gR++k+c++rw + 
  Eucgr.F00002.1.p 18 KGPWSPEEDEALQRLVQSYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 63
                      79******************************.***********985 PP

2Myb_DNA-binding58.31.7e-1872114347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eEde +v+a++++G++ W+tIar ++ gRt++ +k++w++ 
  Eucgr.F00002.1.p  72 PFTPEEDEAIVRAHARFGNK-WATIARLLN-GRTDNAVKNHWNST 114
                       89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.6711368IPR017930Myb domain
SuperFamilySSF466894.12E-3215111IPR009057Homeodomain-like
SMARTSM007175.2E-171766IPR001005SANT/Myb domain
PfamPF002493.0E-181863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-261971IPR009057Homeodomain-like
CDDcd001673.53E-162062No hitNo description
SMARTSM007171.1E-1569117IPR001005SANT/Myb domain
PROSITE profilePS5129421.80870119IPR017930Myb domain
CDDcd001678.27E-1372115No hitNo description
PfamPF002492.0E-1572114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2372118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MASSSSVASA RKDADRIKGP WSPEEDEALQ RLVQSYGPRN WSLISKSIPG RSGKSCRLRW  60
CNQLSPQVEH RPFTPEEDEA IVRAHARFGN KWATIARLLN GRTDNAVKNH WNSTLKRKCS  120
SACSAGGDDA DALAEQQPLK RSASLGTPTG GNNAVSDLFF SPSSPSGSDL SDSGLPVGMP  180
SPRVFRPVAR TGPIMPALSG QHADASSSTT TDPPTLLSLS LPGSDMAEVS NHGSASGSVP  240
TPDSRPSPTL FSARTQTMQA TPPPPPPPLP PPPPIHHLGH YGDRMEAAAG YEKQFFNADF  300
MAVMQEMIRK EVRSYMSGIE QGEAVRNVTV KRIGVSKID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-42171183104C-Myb DNA-Binding Domain
1mse_C9e-42171183104C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3552411e-105AK355241.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1018A13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059753.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-92MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059BJE50.0A0A059BJE5_EUCGR; Uncharacterized protein
STRINGPOPTR_0002s12410.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-72myb domain protein r1